2022 Day 6 Complete!

This commit is contained in:
2022-12-06 07:04:10 -06:00
parent 67300ad82f
commit 235801201f
4 changed files with 165 additions and 0 deletions
+1
View File
@@ -0,0 +1 @@
mgwwjddqzqdqsstctjjsdjsdsrsfsmfsfwwltwlwhwnhhlffzddgffwlffbsfshfshhgvvdrrltlzlnzznrrnrsnnhgnnfjnnvpnnbjjnwwrcwrrhlhvlhhmzmqzqrqtqmqpmpwwmssgsrgrgtgmtgmtgtdtvdvmvsvsbvsbvbtthmmftmmdnmddcrcvcrrfjfhhfjhffjllcpllmcctjtrttwmtwmwffrlrqlqzzpddsqdqqgjqgjgngwnncjnnvsnswwbzbtzzflzzqsqbsbvbmbnnjpnpnnpfpmpmnpmmjljtltssqnsqslstswtwswwjddvmmzlzqlzqzqjjlttmtrtbtmtgmtmsttrctrrsqrqvvrzrcrhhlnhllbfbtthrhdhllmwlmlgglgsgmgsmszzprpwpfprfftffpssjzjgzjzddqfqmmwqwvwlvlqqtbtwwrwttmsmppbmmpcmctcnnhssnjncnlcnctcjjrzrwrfwfcwffczztrtsrtstlsssljssmvssjzssrqqrcqqwlqwlwffsflssrrzhzzhrzzdgdppspwplpqptttvddggzszccrrnzzwwdwjddrvvwggpvgpvvhdhqddffrnngcncjcjlcchrrftrrjccrcrqqgcglcgcscmmlzmmtcmcffwfcfrcrggdmggdvvnrvnnphnngzzpdpgpspqqgrrnffmfpmffmgfmmjmzztlljlggljjcnnrqnqpnqndnffnwwbpwpjwjjlslmsmtmtjttsvsggrmmdpmmcjjswsqqwfwwrwffczfzggqvggdlldhllsdsfdsdhhmmzmjjmpjpddsccqrrjhjlhjjcnnpwnnffjwwcsszrrnmnsmnnjbnndwnnnhnwwjtwtlwtwqqbnqnbnqqfjfdjdbbwbqwqpqggbcbhhtrtqrrddpdwdlwdddzvzwvvdfdpdcdvdtdpttwwdzdzmdmqmzmnzmnmhmwmjwwshhcqcpcvvzgzdggnjnnhwnhhswwvccqrqlqggcngnmggmffblbglltlstshhrjjlvlppsqslljtjtgglvltvlvmllhrhdrrmqrmqmjjdcjjppqwwllvsvsrszslsvvghvvhmmfbfvfpfmmvdvppwggtrrjvvsbbzffbmffpqqqhnhncclzczwcwpwssrprfrsrbsbnbvnnwzwqqpsqsspmssztssstrtcczsznzvvpvttnssdjdhjddngdgvvmsszbzsbsmbbgsbgsgmmhwhghrhjhphshchgglmlvlhlbhlldwdggdsscvcbcssfbbvggvwwtstltrrwttjdtdvttlsttfhfmhhcbclbcbffqqslshlldhdqhhjwwlffrbrdbrrgcrrfmffbhhlslrslrslrlsrsnsnvvqfqnnfdfmfmttmcmcrrcmmmjttjvtvvjbjqjnnbtbnblbtlblplgltlqltlztzvvtdvvtpvvwdwfflbflfrrhbrbbmjmcjmccztzwwjzwwzwdzdnnwcclbllqgghjhlhthwrdglrmcpbmtrnrdtvjrpmzqmljzzrtpzsrhnjrsdmpnsgdhvqchcfqjqdncjqfnscwjqvszpzzfhpjljmvsqnjzmrsgsbzlvrddtdmwbwwgprlvdfflrpztdzrhtmlzrrtdmpmcprqzzwlnmfjvsrltfjgcnnfllnzmbjcbthvbffczsspmczrpgpdjmvrvfmprfmnqdcnfwwvgdrwvrbtlqmhrrjvtrmmgrlprtnzdlszgbtbwztdrmpmlfblshzcnsczlblgwzrpnlccwhmcqhssmpznbdnnqgzzmjprjttdjhmjbmgqvzblsjwmplzsthrswhsdbvtqgrfzmbpqtpqgqdqcvzlgjrtvrhvzgmcmrwdmfpdvjddsmmsnvrdgnsbsdzcbprbqchqcgnwmfsrmqtrcdhdtzztbvmpblftwqlmlmmjcjhhjlgnnhljnncvbnjhgbjrltlwscswgvqmcnssbcdrtbgnhgmpmvjwtrbrbrdbdqfrncvhdstwztwcpbjrjwzmdlwvlvmsrhghjwjnjstbcqjqtjrgcvhzjdhdgbgdlhvjmztwvhgzzggwwhhhzvtrldchztmwfjvnqnvhnwpfvzzvnlvsccmvsngzgtnttssmdmhwzlhtpnfhczsdfnrstbwvwpqmslcvpvhfzttzhsgzpbhqdtswshljpncznjhzmgvvbcllmzprhrvwljwcjpcdqmwbzvsdcgtmwnrhswsgqhwpwhbjpnhnpjvgsqcjltzrqvqfflcdcvpwnznvtqbfbtlpmtdgbbwdwncqsqnbtgfdzzqzzvjnwmzdmlgstmnjwznjqghglvmwjzlqrnddcqhgndlhlbmqdhrqgrjqztnhpzssnwmrqclmwpgbvfrvgqqvtthznsqwgndjrprbgrhcvhpzbfhdmgnhsrqjvjstbtmnltsbjfzczvjqnhtldqclsflbhvvlzjwrqqgbgpwqwpfjctqpzdqwcfstmwbzgrgrtzngljjnvtggrqcbgjwtqsdgwmfjqppnzgfsfdmlctztbhnntnntdlvrsdvnllvmpggjzspqfhzwrttwzpqrnqjhmpjnmrzrpnqzshcqgctbtflqflcrzpmnphgbbghhwzplljwngbtffwmrwggdztvtfgwldlswqvjptvbfvnbpglhgrdgcfmvrslqldmwjqvjpvwgpjddvglllvpqwvbchqsmjrncgvgmqbsbcwfbsbpqcqzjfpcdzszgmvqgqjlflpfzbsrhsrzrdbpssrjbcfhvztftlzqpsglpwhbscgwdlbgghzsbwznnbgnnsgjghmmpmmrmqmdhnflgvgprqfcbpzbcpjscvnpfrmtvzsbflmffvcfsvdsggzdqtppcjzphcqwrqtrczqmwcdmdqndzmhdpnfqsbndnvjlzrsjzmpcrfgjwccsdtzvslccwhlvzjwjgvwpsnsggmqgsjfbwmjstsgnqmtjhljvfnflnngdrqvscwlqqdsglhghczhjdvgrjcqblmncdbjvsbwgptgpvvzhcjgjnvttrgzrjnqlvfbrmpzdcbbnnrqptpzpssznbsrstdphbgdrsnrhcjwwgsncdzvqfnmnvqcmcgdgjdbqjzdrvvbvhjdfcqndmqwscmsvppclzrhgbldqtwctbdhpbbwfvwpcpsvddmrhqbhlrrmrblnmqqqbwvcwwbwprlmhtdncmjhmjgphmrrhcdrqgmcrzwsznqzpngbtsvjgglrddhjflbrhvqwmmhmqzhphwnvqwzczdvqjsnlhfqbcgddtwgnlcgbfqmzfpqmnbpvfhdhjlnwtrlmggtbfnfvmqrzjvjjvffctsrwgfcpghhnzqmwtlsfhjrvqpwqhngrhpswslsvtgnbvbmwsfwmpntfsfpshrjzvghhpvnlbmnrhltfpmqdwzfhztvhlmbnmhnbvdzbbtczvwbvwtvjghhjjrtgbrqrhmbgvssstdwztdmdsqtctghjhsnpslqttdlvndmjfnmdzwrblfjqcwptfttvlcgsvwcbmfzbdlmrtchgqlfspwznbzfjthjtfwshqgfsfdsmzsmpptzschlzjshvfwtmpszvrvlggbrgpcnqwndhjjprztdfddblhfljbvttfvhchhdfsftrhccrbncmhwpcpwfqthngcqptmvsmpcswdrdlcbqvvhwmcqqwbzlblrgfcrrndwdvlvnpjvwchzjzmgrqhzzmgqqdsdflpclpdtlhvhcthzjfbvjvzsnbvwfsnglvbnwnbgrqwpbgclhjhztttbjwvmlmmgmzncbwswncqhmcfjfnwnpbrmchhpgwngrfwgdfdqmblwlghdjvdhjftdblrtcvvgbvpmbjhfwgpmghqbqrcpgfvhtvqtlbjdblggcpjzlrhpbsqwntfhbhwwszpdlsgbpfqhvrjrhsldcgvqhqmwdfcrcmhrvvwvbrfsrrcvwzhqqvgltlnhwhdrhrdqsvmdzjwgmqdsccwhcgwltfhdfqpsltjccwsttmrc
+51
View File
@@ -0,0 +1,51 @@
package main
import (
"fmt"
h "git.bullercodeworks.com/brian/adventofcode/helpers"
)
func main() {
inp := h.StdinToString()
fmt.Println("# Part 1")
fmt.Printf("First Start of Packet @ %d\n", findFirstStartOfPacket(inp))
fmt.Println("")
fmt.Println("# Part 2")
fmt.Printf("First Start of Message @ %d\n", findFirstStartOfMessage(inp))
}
func findFirstStartOfPacket(inp string) int {
return findFirstWithXUnique(inp, 4)
}
func findFirstStartOfMessage(inp string) int {
return findFirstWithXUnique(inp, 14)
}
func findFirstWithXUnique(inp string, x int) int {
for i := range inp {
if i < x {
continue
}
if findUniqueCountBefore(inp, i) >= x {
return i + 1
}
}
return -1
}
func findUniqueCountBefore(inp string, pos int) int {
if len(inp) < pos {
return -1
}
counts := make(map[byte]int)
for i := pos; i >= 0; i-- {
if _, ok := counts[inp[i]]; !ok {
counts[inp[i]]++
} else {
return len(counts)
}
}
return pos
}
+112
View File
@@ -0,0 +1,112 @@
Advent of Code
br0xen (AoC++) 12*
{ʼyearʼ:2022}
--- Day 6: Tuning Trouble ---
The preparations are finally complete; you and the Elves leave camp on
foot and begin to make your way toward the star fruit grove.
As you move through the dense undergrowth, one of the Elves gives you a
handheld device. He says that it has many fancy features, but the most
important one to set up right now is the communication system.
However, because he's heard you have significant experience dealing with
signal-based systems, he convinced the other Elves that it would be okay
to give you their one malfunctioning device - surely you'll have no
problem fixing it.
As if inspired by comedic timing, the device emits a few colorful sparks.
To be able to communicate with the Elves, the device needs to lock on to
their signal. The signal is a series of seemingly-random characters that
the device receives one at a time.
To fix the communication system, you need to add a subroutine to the
device that detects a start-of-packet marker in the datastream. In the
protocol being used by the Elves, the start of a packet is indicated by a
sequence of four characters that are all different.
The device will send your subroutine a datastream buffer (your puzzle
input); your subroutine needs to identify the first position where the
four most recently received characters were all different. Specifically,
it needs to report the number of characters from the beginning of the
buffer to the end of the first such four-character marker.
For example, suppose you receive the following datastream buffer:
mjqjpqmgbljsphdztnvjfqwrcgsmlb
After the first three characters (mjq) have been received, there haven't
been enough characters received yet to find the marker. The first time a
marker could occur is after the fourth character is received, making the
most recent four characters mjqj. Because j is repeated, this isn't a
marker.
The first time a marker appears is after the seventh character arrives.
Once it does, the last four characters received are jpqm, which are all
different. In this case, your subroutine should report the value 7,
because the first start-of-packet marker is complete after 7 characters
have been processed.
Here are a few more examples:
• bvwbjplbgvbhsrlpgdmjqwftvncz: first marker after character 5
• nppdvjthqldpwncqszvftbrmjlhg: first marker after character 6
• nznrnfrfntjfmvfwmzdfjlvtqnbhcprsg: first marker after character 10
• zcfzfwzzqfrljwzlrfnpqdbhtmscgvjw: first marker after character 11
How many characters need to be processed before the first start-of-packet
marker is detected?
Your puzzle answer was 1544.
--- Part Two ---
Your device's communication system is correctly detecting packets, but
still isn't working. It looks like it also needs to look for messages.
A start-of-message marker is just like a start-of-packet marker, except it
consists of 14 distinct characters rather than 4.
Here are the first positions of start-of-message markers for all of the
above examples:
• mjqjpqmgbljsphdztnvjfqwrcgsmlb: first marker after character 19
• bvwbjplbgvbhsrlpgdmjqwftvncz: first marker after character 23
• nppdvjthqldpwncqszvftbrmjlhg: first marker after character 23
• nznrnfrfntjfmvfwmzdfjlvtqnbhcprsg: first marker after character 29
• zcfzfwzzqfrljwzlrfnpqdbhtmscgvjw: first marker after character 26
How many characters need to be processed before the first start-of-message
marker is detected?
Your puzzle answer was 2145.
Both parts of this puzzle are complete! They provide two gold stars: **
References
Visible links
. https://adventofcode.com/
. https://adventofcode.com/2022/about
. https://adventofcode.com/2022/events
. https://adventofcode.com/2022/settings
. https://adventofcode.com/2022/auth/logout
. Advent of Code Supporter
https://adventofcode.com/2022/support
. https://adventofcode.com/2022
. https://adventofcode.com/2022
. https://adventofcode.com/2022/support
. https://adventofcode.com/2022/sponsors
. https://adventofcode.com/2022/leaderboard
. https://adventofcode.com/2022/stats
. https://adventofcode.com/2022/sponsors
. https://adventofcode.com/2016/day/6
. https://adventofcode.com/2016/day/25
. https://adventofcode.com/2019/day/7
. https://adventofcode.com/2019/day/9
. https://adventofcode.com/2019/day/16
. https://adventofcode.com/2021/day/25
. https://adventofcode.com/2022
. https://adventofcode.com/2022/day/6/input
+1
View File
@@ -0,0 +1 @@
mjqjpqmgbljsphdztnvjfqwrcgsmlb