2022 Day 6 Complete!
This commit is contained in:
parent
67300ad82f
commit
235801201f
1
2022/day06/input
Normal file
1
2022/day06/input
Normal file
@ -0,0 +1 @@
|
||||
mgwwjddqzqdqsstctjjsdjsdsrsfsmfsfwwltwlwhwnhhlffzddgffwlffbsfshfshhgvvdrrltlzlnzznrrnrsnnhgnnfjnnvpnnbjjnwwrcwrrhlhvlhhmzmqzqrqtqmqpmpwwmssgsrgrgtgmtgmtgtdtvdvmvsvsbvsbvbtthmmftmmdnmddcrcvcrrfjfhhfjhffjllcpllmcctjtrttwmtwmwffrlrqlqzzpddsqdqqgjqgjgngwnncjnnvsnswwbzbtzzflzzqsqbsbvbmbnnjpnpnnpfpmpmnpmmjljtltssqnsqslstswtwswwjddvmmzlzqlzqzqjjlttmtrtbtmtgmtmsttrctrrsqrqvvrzrcrhhlnhllbfbtthrhdhllmwlmlgglgsgmgsmszzprpwpfprfftffpssjzjgzjzddqfqmmwqwvwlvlqqtbtwwrwttmsmppbmmpcmctcnnhssnjncnlcnctcjjrzrwrfwfcwffczztrtsrtstlsssljssmvssjzssrqqrcqqwlqwlwffsflssrrzhzzhrzzdgdppspwplpqptttvddggzszccrrnzzwwdwjddrvvwggpvgpvvhdhqddffrnngcncjcjlcchrrftrrjccrcrqqgcglcgcscmmlzmmtcmcffwfcfrcrggdmggdvvnrvnnphnngzzpdpgpspqqgrrnffmfpmffmgfmmjmzztlljlggljjcnnrqnqpnqndnffnwwbpwpjwjjlslmsmtmtjttsvsggrmmdpmmcjjswsqqwfwwrwffczfzggqvggdlldhllsdsfdsdhhmmzmjjmpjpddsccqrrjhjlhjjcnnpwnnffjwwcsszrrnmnsmnnjbnndwnnnhnwwjtwtlwtwqqbnqnbnqqfjfdjdbbwbqwqpqggbcbhhtrtqrrddpdwdlwdddzvzwvvdfdpdcdvdtdpttwwdzdzmdmqmzmnzmnmhmwmjwwshhcqcpcvvzgzdggnjnnhwnhhswwvccqrqlqggcngnmggmffblbglltlstshhrjjlvlppsqslljtjtgglvltvlvmllhrhdrrmqrmqmjjdcjjppqwwllvsvsrszslsvvghvvhmmfbfvfpfmmvdvppwggtrrjvvsbbzffbmffpqqqhnhncclzczwcwpwssrprfrsrbsbnbvnnwzwqqpsqsspmssztssstrtcczsznzvvpvttnssdjdhjddngdgvvmsszbzsbsmbbgsbgsgmmhwhghrhjhphshchgglmlvlhlbhlldwdggdsscvcbcssfbbvggvwwtstltrrwttjdtdvttlsttfhfmhhcbclbcbffqqslshlldhdqhhjwwlffrbrdbrrgcrrfmffbhhlslrslrslrlsrsnsnvvqfqnnfdfmfmttmcmcrrcmmmjttjvtvvjbjqjnnbtbnblbtlblplgltlqltlztzvvtdvvtpvvwdwfflbflfrrhbrbbmjmcjmccztzwwjzwwzwdzdnnwcclbllqgghjhlhthwrdglrmcpbmtrnrdtvjrpmzqmljzzrtpzsrhnjrsdmpnsgdhvqchcfqjqdncjqfnscwjqvszpzzfhpjljmvsqnjzmrsgsbzlvrddtdmwbwwgprlvdfflrpztdzrhtmlzrrtdmpmcprqzzwlnmfjvsrltfjgcnnfllnzmbjcbthvbffczsspmczrpgpdjmvrvfmprfmnqdcnfwwvgdrwvrbtlqmhrrjvtrmmgrlprtnzdlszgbtbwztdrmpmlfblshzcnsczlblgwzrpnlccwhmcqhssmpznbdnnqgzzmjprjttdjhmjbmgqvzblsjwmplzsthrswhsdbvtqgrfzmbpqtpqgqdqcvzlgjrtvrhvzgmcmrwdmfpdvjddsmmsnvrdgnsbsdzcbprbqchqcgnwmfsrmqtrcdhdtzztbvmpblftwqlmlmmjcjhhjlgnnhljnncvbnjhgbjrltlwscswgvqmcnssbcdrtbgnhgmpmvjwtrbrbrdbdqfrncvhdstwztwcpbjrjwzmdlwvlvmsrhghjwjnjstbcqjqtjrgcvhzjdhdgbgdlhvjmztwvhgzzggwwhhhzvtrldchztmwfjvnqnvhnwpfvzzvnlvsccmvsngzgtnttssmdmhwzlhtpnfhczsdfnrstbwvwpqmslcvpvhfzttzhsgzpbhqdtswshljpncznjhzmgvvbcllmzprhrvwljwcjpcdqmwbzvsdcgtmwnrhswsgqhwpwhbjpnhnpjvgsqcjltzrqvqfflcdcvpwnznvtqbfbtlpmtdgbbwdwncqsqnbtgfdzzqzzvjnwmzdmlgstmnjwznjqghglvmwjzlqrnddcqhgndlhlbmqdhrqgrjqztnhpzssnwmrqclmwpgbvfrvgqqvtthznsqwgndjrprbgrhcvhpzbfhdmgnhsrqjvjstbtmnltsbjfzczvjqnhtldqclsflbhvvlzjwrqqgbgpwqwpfjctqpzdqwcfstmwbzgrgrtzngljjnvtggrqcbgjwtqsdgwmfjqppnzgfsfdmlctztbhnntnntdlvrsdvnllvmpggjzspqfhzwrttwzpqrnqjhmpjnmrzrpnqzshcqgctbtflqflcrzpmnphgbbghhwzplljwngbtffwmrwggdztvtfgwldlswqvjptvbfvnbpglhgrdgcfmvrslqldmwjqvjpvwgpjddvglllvpqwvbchqsmjrncgvgmqbsbcwfbsbpqcqzjfpcdzszgmvqgqjlflpfzbsrhsrzrdbpssrjbcfhvztftlzqpsglpwhbscgwdlbgghzsbwznnbgnnsgjghmmpmmrmqmdhnflgvgprqfcbpzbcpjscvnpfrmtvzsbflmffvcfsvdsggzdqtppcjzphcqwrqtrczqmwcdmdqndzmhdpnfqsbndnvjlzrsjzmpcrfgjwccsdtzvslccwhlvzjwjgvwpsnsggmqgsjfbwmjstsgnqmtjhljvfnflnngdrqvscwlqqdsglhghczhjdvgrjcqblmncdbjvsbwgptgpvvzhcjgjnvttrgzrjnqlvfbrmpzdcbbnnrqptpzpssznbsrstdphbgdrsnrhcjwwgsncdzvqfnmnvqcmcgdgjdbqjzdrvvbvhjdfcqndmqwscmsvppclzrhgbldqtwctbdhpbbwfvwpcpsvddmrhqbhlrrmrblnmqqqbwvcwwbwprlmhtdncmjhmjgphmrrhcdrqgmcrzwsznqzpngbtsvjgglrddhjflbrhvqwmmhmqzhphwnvqwzczdvqjsnlhfqbcgddtwgnlcgbfqmzfpqmnbpvfhdhjlnwtrlmggtbfnfvmqrzjvjjvffctsrwgfcpghhnzqmwtlsfhjrvqpwqhngrhpswslsvtgnbvbmwsfwmpntfsfpshrjzvghhpvnlbmnrhltfpmqdwzfhztvhlmbnmhnbvdzbbtczvwbvwtvjghhjjrtgbrqrhmbgvssstdwztdmdsqtctghjhsnpslqttdlvndmjfnmdzwrblfjqcwptfttvlcgsvwcbmfzbdlmrtchgqlfspwznbzfjthjtfwshqgfsfdsmzsmpptzschlzjshvfwtmpszvrvlggbrgpcnqwndhjjprztdfddblhfljbvttfvhchhdfsftrhccrbncmhwpcpwfqthngcqptmvsmpcswdrdlcbqvvhwmcqqwbzlblrgfcrrndwdvlvnpjvwchzjzmgrqhzzmgqqdsdflpclpdtlhvhcthzjfbvjvzsnbvwfsnglvbnwnbgrqwpbgclhjhztttbjwvmlmmgmzncbwswncqhmcfjfnwnpbrmchhpgwngrfwgdfdqmblwlghdjvdhjftdblrtcvvgbvpmbjhfwgpmghqbqrcpgfvhtvqtlbjdblggcpjzlrhpbsqwntfhbhwwszpdlsgbpfqhvrjrhsldcgvqhqmwdfcrcmhrvvwvbrfsrrcvwzhqqvgltlnhwhdrhrdqsvmdzjwgmqdsccwhcgwltfhdfqpsltjccwsttmrc
|
51
2022/day06/main.go
Normal file
51
2022/day06/main.go
Normal file
@ -0,0 +1,51 @@
|
||||
package main
|
||||
|
||||
import (
|
||||
"fmt"
|
||||
|
||||
h "git.bullercodeworks.com/brian/adventofcode/helpers"
|
||||
)
|
||||
|
||||
func main() {
|
||||
inp := h.StdinToString()
|
||||
fmt.Println("# Part 1")
|
||||
fmt.Printf("First Start of Packet @ %d\n", findFirstStartOfPacket(inp))
|
||||
fmt.Println("")
|
||||
fmt.Println("# Part 2")
|
||||
fmt.Printf("First Start of Message @ %d\n", findFirstStartOfMessage(inp))
|
||||
}
|
||||
|
||||
func findFirstStartOfPacket(inp string) int {
|
||||
return findFirstWithXUnique(inp, 4)
|
||||
}
|
||||
|
||||
func findFirstStartOfMessage(inp string) int {
|
||||
return findFirstWithXUnique(inp, 14)
|
||||
}
|
||||
|
||||
func findFirstWithXUnique(inp string, x int) int {
|
||||
for i := range inp {
|
||||
if i < x {
|
||||
continue
|
||||
}
|
||||
if findUniqueCountBefore(inp, i) >= x {
|
||||
return i + 1
|
||||
}
|
||||
}
|
||||
return -1
|
||||
}
|
||||
|
||||
func findUniqueCountBefore(inp string, pos int) int {
|
||||
if len(inp) < pos {
|
||||
return -1
|
||||
}
|
||||
counts := make(map[byte]int)
|
||||
for i := pos; i >= 0; i-- {
|
||||
if _, ok := counts[inp[i]]; !ok {
|
||||
counts[inp[i]]++
|
||||
} else {
|
||||
return len(counts)
|
||||
}
|
||||
}
|
||||
return pos
|
||||
}
|
112
2022/day06/problem
Normal file
112
2022/day06/problem
Normal file
@ -0,0 +1,112 @@
|
||||
Advent of Code
|
||||
br0xen (AoC++) 12*
|
||||
{ʼyearʼ:2022}
|
||||
|
||||
--- Day 6: Tuning Trouble ---
|
||||
|
||||
The preparations are finally complete; you and the Elves leave camp on
|
||||
foot and begin to make your way toward the star fruit grove.
|
||||
|
||||
As you move through the dense undergrowth, one of the Elves gives you a
|
||||
handheld device. He says that it has many fancy features, but the most
|
||||
important one to set up right now is the communication system.
|
||||
|
||||
However, because he's heard you have significant experience dealing with
|
||||
signal-based systems, he convinced the other Elves that it would be okay
|
||||
to give you their one malfunctioning device - surely you'll have no
|
||||
problem fixing it.
|
||||
|
||||
As if inspired by comedic timing, the device emits a few colorful sparks.
|
||||
|
||||
To be able to communicate with the Elves, the device needs to lock on to
|
||||
their signal. The signal is a series of seemingly-random characters that
|
||||
the device receives one at a time.
|
||||
|
||||
To fix the communication system, you need to add a subroutine to the
|
||||
device that detects a start-of-packet marker in the datastream. In the
|
||||
protocol being used by the Elves, the start of a packet is indicated by a
|
||||
sequence of four characters that are all different.
|
||||
|
||||
The device will send your subroutine a datastream buffer (your puzzle
|
||||
input); your subroutine needs to identify the first position where the
|
||||
four most recently received characters were all different. Specifically,
|
||||
it needs to report the number of characters from the beginning of the
|
||||
buffer to the end of the first such four-character marker.
|
||||
|
||||
For example, suppose you receive the following datastream buffer:
|
||||
|
||||
mjqjpqmgbljsphdztnvjfqwrcgsmlb
|
||||
|
||||
After the first three characters (mjq) have been received, there haven't
|
||||
been enough characters received yet to find the marker. The first time a
|
||||
marker could occur is after the fourth character is received, making the
|
||||
most recent four characters mjqj. Because j is repeated, this isn't a
|
||||
marker.
|
||||
|
||||
The first time a marker appears is after the seventh character arrives.
|
||||
Once it does, the last four characters received are jpqm, which are all
|
||||
different. In this case, your subroutine should report the value 7,
|
||||
because the first start-of-packet marker is complete after 7 characters
|
||||
have been processed.
|
||||
|
||||
Here are a few more examples:
|
||||
|
||||
• bvwbjplbgvbhsrlpgdmjqwftvncz: first marker after character 5
|
||||
• nppdvjthqldpwncqszvftbrmjlhg: first marker after character 6
|
||||
• nznrnfrfntjfmvfwmzdfjlvtqnbhcprsg: first marker after character 10
|
||||
• zcfzfwzzqfrljwzlrfnpqdbhtmscgvjw: first marker after character 11
|
||||
|
||||
How many characters need to be processed before the first start-of-packet
|
||||
marker is detected?
|
||||
|
||||
Your puzzle answer was 1544.
|
||||
|
||||
--- Part Two ---
|
||||
|
||||
Your device's communication system is correctly detecting packets, but
|
||||
still isn't working. It looks like it also needs to look for messages.
|
||||
|
||||
A start-of-message marker is just like a start-of-packet marker, except it
|
||||
consists of 14 distinct characters rather than 4.
|
||||
|
||||
Here are the first positions of start-of-message markers for all of the
|
||||
above examples:
|
||||
|
||||
• mjqjpqmgbljsphdztnvjfqwrcgsmlb: first marker after character 19
|
||||
• bvwbjplbgvbhsrlpgdmjqwftvncz: first marker after character 23
|
||||
• nppdvjthqldpwncqszvftbrmjlhg: first marker after character 23
|
||||
• nznrnfrfntjfmvfwmzdfjlvtqnbhcprsg: first marker after character 29
|
||||
• zcfzfwzzqfrljwzlrfnpqdbhtmscgvjw: first marker after character 26
|
||||
|
||||
How many characters need to be processed before the first start-of-message
|
||||
marker is detected?
|
||||
|
||||
Your puzzle answer was 2145.
|
||||
|
||||
Both parts of this puzzle are complete! They provide two gold stars: **
|
||||
|
||||
References
|
||||
|
||||
Visible links
|
||||
. https://adventofcode.com/
|
||||
. https://adventofcode.com/2022/about
|
||||
. https://adventofcode.com/2022/events
|
||||
. https://adventofcode.com/2022/settings
|
||||
. https://adventofcode.com/2022/auth/logout
|
||||
. Advent of Code Supporter
|
||||
https://adventofcode.com/2022/support
|
||||
. https://adventofcode.com/2022
|
||||
. https://adventofcode.com/2022
|
||||
. https://adventofcode.com/2022/support
|
||||
. https://adventofcode.com/2022/sponsors
|
||||
. https://adventofcode.com/2022/leaderboard
|
||||
. https://adventofcode.com/2022/stats
|
||||
. https://adventofcode.com/2022/sponsors
|
||||
. https://adventofcode.com/2016/day/6
|
||||
. https://adventofcode.com/2016/day/25
|
||||
. https://adventofcode.com/2019/day/7
|
||||
. https://adventofcode.com/2019/day/9
|
||||
. https://adventofcode.com/2019/day/16
|
||||
. https://adventofcode.com/2021/day/25
|
||||
. https://adventofcode.com/2022
|
||||
. https://adventofcode.com/2022/day/6/input
|
1
2022/day06/testinput
Normal file
1
2022/day06/testinput
Normal file
@ -0,0 +1 @@
|
||||
mjqjpqmgbljsphdztnvjfqwrcgsmlb
|
Loading…
Reference in New Issue
Block a user