2022 Day 6 Complete!
This commit is contained in:
parent
67300ad82f
commit
235801201f
|
@ -0,0 +1 @@
|
||||||
|
mgwwjddqzqdqsstctjjsdjsdsrsfsmfsfwwltwlwhwnhhlffzddgffwlffbsfshfshhgvvdrrltlzlnzznrrnrsnnhgnnfjnnvpnnbjjnwwrcwrrhlhvlhhmzmqzqrqtqmqpmpwwmssgsrgrgtgmtgmtgtdtvdvmvsvsbvsbvbtthmmftmmdnmddcrcvcrrfjfhhfjhffjllcpllmcctjtrttwmtwmwffrlrqlqzzpddsqdqqgjqgjgngwnncjnnvsnswwbzbtzzflzzqsqbsbvbmbnnjpnpnnpfpmpmnpmmjljtltssqnsqslstswtwswwjddvmmzlzqlzqzqjjlttmtrtbtmtgmtmsttrctrrsqrqvvrzrcrhhlnhllbfbtthrhdhllmwlmlgglgsgmgsmszzprpwpfprfftffpssjzjgzjzddqfqmmwqwvwlvlqqtbtwwrwttmsmppbmmpcmctcnnhssnjncnlcnctcjjrzrwrfwfcwffczztrtsrtstlsssljssmvssjzssrqqrcqqwlqwlwffsflssrrzhzzhrzzdgdppspwplpqptttvddggzszccrrnzzwwdwjddrvvwggpvgpvvhdhqddffrnngcncjcjlcchrrftrrjccrcrqqgcglcgcscmmlzmmtcmcffwfcfrcrggdmggdvvnrvnnphnngzzpdpgpspqqgrrnffmfpmffmgfmmjmzztlljlggljjcnnrqnqpnqndnffnwwbpwpjwjjlslmsmtmtjttsvsggrmmdpmmcjjswsqqwfwwrwffczfzggqvggdlldhllsdsfdsdhhmmzmjjmpjpddsccqrrjhjlhjjcnnpwnnffjwwcsszrrnmnsmnnjbnndwnnnhnwwjtwtlwtwqqbnqnbnqqfjfdjdbbwbqwqpqggbcbhhtrtqrrddpdwdlwdddzvzwvvdfdpdcdvdtdpttwwdzdzmdmqmzmnzmnmhmwmjwwshhcqcpcvvzgzdggnjnnhwnhhswwvccqrqlqggcngnmggmffblbglltlstshhrjjlvlppsqslljtjtgglvltvlvmllhrhdrrmqrmqmjjdcjjppqwwllvsvsrszslsvvghvvhmmfbfvfpfmmvdvppwggtrrjvvsbbzffbmffpqqqhnhncclzczwcwpwssrprfrsrbsbnbvnnwzwqqpsqsspmssztssstrtcczsznzvvpvttnssdjdhjddngdgvvmsszbzsbsmbbgsbgsgmmhwhghrhjhphshchgglmlvlhlbhlldwdggdsscvcbcssfbbvggvwwtstltrrwttjdtdvttlsttfhfmhhcbclbcbffqqslshlldhdqhhjwwlffrbrdbrrgcrrfmffbhhlslrslrslrlsrsnsnvvqfqnnfdfmfmttmcmcrrcmmmjttjvtvvjbjqjnnbtbnblbtlblplgltlqltlztzvvtdvvtpvvwdwfflbflfrrhbrbbmjmcjmccztzwwjzwwzwdzdnnwcclbllqgghjhlhthwrdglrmcpbmtrnrdtvjrpmzqmljzzrtpzsrhnjrsdmpnsgdhvqchcfqjqdncjqfnscwjqvszpzzfhpjljmvsqnjzmrsgsbzlvrddtdmwbwwgprlvdfflrpztdzrhtmlzrrtdmpmcprqzzwlnmfjvsrltfjgcnnfllnzmbjcbthvbffczsspmczrpgpdjmvrvfmprfmnqdcnfwwvgdrwvrbtlqmhrrjvtrmmgrlprtnzdlszgbtbwztdrmpmlfblshzcnsczlblgwzrpnlccwhmcqhssmpznbdnnqgzzmjprjttdjhmjbmgqvzblsjwmplzsthrswhsdbvtqgrfzmbpqtpqgqdqcvzlgjrtvrhvzgmcmrwdmfpdvjddsmmsnvrdgnsbsdzcbprbqchqcgnwmfsrmqtrcdhdtzztbvmpblftwqlmlmmjcjhhjlgnnhljnncvbnjhgbjrltlwscswgvqmcnssbcdrtbgnhgmpmvjwtrbrbrdbdqfrncvhdstwztwcpbjrjwzmdlwvlvmsrhghjwjnjstbcqjqtjrgcvhzjdhdgbgdlhvjmztwvhgzzggwwhhhzvtrldchztmwfjvnqnvhnwpfvzzvnlvsccmvsngzgtnttssmdmhwzlhtpnfhczsdfnrstbwvwpqmslcvpvhfzttzhsgzpbhqdtswshljpncznjhzmgvvbcllmzprhrvwljwcjpcdqmwbzvsdcgtmwnrhswsgqhwpwhbjpnhnpjvgsqcjltzrqvqfflcdcvpwnznvtqbfbtlpmtdgbbwdwncqsqnbtgfdzzqzzvjnwmzdmlgstmnjwznjqghglvmwjzlqrnddcqhgndlhlbmqdhrqgrjqztnhpzssnwmrqclmwpgbvfrvgqqvtthznsqwgndjrprbgrhcvhpzbfhdmgnhsrqjvjstbtmnltsbjfzczvjqnhtldqclsflbhvvlzjwrqqgbgpwqwpfjctqpzdqwcfstmwbzgrgrtzngljjnvtggrqcbgjwtqsdgwmfjqppnzgfsfdmlctztbhnntnntdlvrsdvnllvmpggjzspqfhzwrttwzpqrnqjhmpjnmrzrpnqzshcqgctbtflqflcrzpmnphgbbghhwzplljwngbtffwmrwggdztvtfgwldlswqvjptvbfvnbpglhgrdgcfmvrslqldmwjqvjpvwgpjddvglllvpqwvbchqsmjrncgvgmqbsbcwfbsbpqcqzjfpcdzszgmvqgqjlflpfzbsrhsrzrdbpssrjbcfhvztftlzqpsglpwhbscgwdlbgghzsbwznnbgnnsgjghmmpmmrmqmdhnflgvgprqfcbpzbcpjscvnpfrmtvzsbflmffvcfsvdsggzdqtppcjzphcqwrqtrczqmwcdmdqndzmhdpnfqsbndnvjlzrsjzmpcrfgjwccsdtzvslccwhlvzjwjgvwpsnsggmqgsjfbwmjstsgnqmtjhljvfnflnngdrqvscwlqqdsglhghczhjdvgrjcqblmncdbjvsbwgptgpvvzhcjgjnvttrgzrjnqlvfbrmpzdcbbnnrqptpzpssznbsrstdphbgdrsnrhcjwwgsncdzvqfnmnvqcmcgdgjdbqjzdrvvbvhjdfcqndmqwscmsvppclzrhgbldqtwctbdhpbbwfvwpcpsvddmrhqbhlrrmrblnmqqqbwvcwwbwprlmhtdncmjhmjgphmrrhcdrqgmcrzwsznqzpngbtsvjgglrddhjflbrhvqwmmhmqzhphwnvqwzczdvqjsnlhfqbcgddtwgnlcgbfqmzfpqmnbpvfhdhjlnwtrlmggtbfnfvmqrzjvjjvffctsrwgfcpghhnzqmwtlsfhjrvqpwqhngrhpswslsvtgnbvbmwsfwmpntfsfpshrjzvghhpvnlbmnrhltfpmqdwzfhztvhlmbnmhnbvdzbbtczvwbvwtvjghhjjrtgbrqrhmbgvssstdwztdmdsqtctghjhsnpslqttdlvndmjfnmdzwrblfjqcwptfttvlcgsvwcbmfzbdlmrtchgqlfspwznbzfjthjtfwshqgfsfdsmzsmpptzschlzjshvfwtmpszvrvlggbrgpcnqwndhjjprztdfddblhfljbvttfvhchhdfsftrhccrbncmhwpcpwfqthngcqptmvsmpcswdrdlcbqvvhwmcqqwbzlblrgfcrrndwdvlvnpjvwchzjzmgrqhzzmgqqdsdflpclpdtlhvhcthzjfbvjvzsnbvwfsnglvbnwnbgrqwpbgclhjhztttbjwvmlmmgmzncbwswncqhmcfjfnwnpbrmchhpgwngrfwgdfdqmblwlghdjvdhjftdblrtcvvgbvpmbjhfwgpmghqbqrcpgfvhtvqtlbjdblggcpjzlrhpbsqwntfhbhwwszpdlsgbpfqhvrjrhsldcgvqhqmwdfcrcmhrvvwvbrfsrrcvwzhqqvgltlnhwhdrhrdqsvmdzjwgmqdsccwhcgwltfhdfqpsltjccwsttmrc
|
|
@ -0,0 +1,51 @@
|
||||||
|
package main
|
||||||
|
|
||||||
|
import (
|
||||||
|
"fmt"
|
||||||
|
|
||||||
|
h "git.bullercodeworks.com/brian/adventofcode/helpers"
|
||||||
|
)
|
||||||
|
|
||||||
|
func main() {
|
||||||
|
inp := h.StdinToString()
|
||||||
|
fmt.Println("# Part 1")
|
||||||
|
fmt.Printf("First Start of Packet @ %d\n", findFirstStartOfPacket(inp))
|
||||||
|
fmt.Println("")
|
||||||
|
fmt.Println("# Part 2")
|
||||||
|
fmt.Printf("First Start of Message @ %d\n", findFirstStartOfMessage(inp))
|
||||||
|
}
|
||||||
|
|
||||||
|
func findFirstStartOfPacket(inp string) int {
|
||||||
|
return findFirstWithXUnique(inp, 4)
|
||||||
|
}
|
||||||
|
|
||||||
|
func findFirstStartOfMessage(inp string) int {
|
||||||
|
return findFirstWithXUnique(inp, 14)
|
||||||
|
}
|
||||||
|
|
||||||
|
func findFirstWithXUnique(inp string, x int) int {
|
||||||
|
for i := range inp {
|
||||||
|
if i < x {
|
||||||
|
continue
|
||||||
|
}
|
||||||
|
if findUniqueCountBefore(inp, i) >= x {
|
||||||
|
return i + 1
|
||||||
|
}
|
||||||
|
}
|
||||||
|
return -1
|
||||||
|
}
|
||||||
|
|
||||||
|
func findUniqueCountBefore(inp string, pos int) int {
|
||||||
|
if len(inp) < pos {
|
||||||
|
return -1
|
||||||
|
}
|
||||||
|
counts := make(map[byte]int)
|
||||||
|
for i := pos; i >= 0; i-- {
|
||||||
|
if _, ok := counts[inp[i]]; !ok {
|
||||||
|
counts[inp[i]]++
|
||||||
|
} else {
|
||||||
|
return len(counts)
|
||||||
|
}
|
||||||
|
}
|
||||||
|
return pos
|
||||||
|
}
|
|
@ -0,0 +1,112 @@
|
||||||
|
Advent of Code
|
||||||
|
br0xen (AoC++) 12*
|
||||||
|
{ʼyearʼ:2022}
|
||||||
|
|
||||||
|
--- Day 6: Tuning Trouble ---
|
||||||
|
|
||||||
|
The preparations are finally complete; you and the Elves leave camp on
|
||||||
|
foot and begin to make your way toward the star fruit grove.
|
||||||
|
|
||||||
|
As you move through the dense undergrowth, one of the Elves gives you a
|
||||||
|
handheld device. He says that it has many fancy features, but the most
|
||||||
|
important one to set up right now is the communication system.
|
||||||
|
|
||||||
|
However, because he's heard you have significant experience dealing with
|
||||||
|
signal-based systems, he convinced the other Elves that it would be okay
|
||||||
|
to give you their one malfunctioning device - surely you'll have no
|
||||||
|
problem fixing it.
|
||||||
|
|
||||||
|
As if inspired by comedic timing, the device emits a few colorful sparks.
|
||||||
|
|
||||||
|
To be able to communicate with the Elves, the device needs to lock on to
|
||||||
|
their signal. The signal is a series of seemingly-random characters that
|
||||||
|
the device receives one at a time.
|
||||||
|
|
||||||
|
To fix the communication system, you need to add a subroutine to the
|
||||||
|
device that detects a start-of-packet marker in the datastream. In the
|
||||||
|
protocol being used by the Elves, the start of a packet is indicated by a
|
||||||
|
sequence of four characters that are all different.
|
||||||
|
|
||||||
|
The device will send your subroutine a datastream buffer (your puzzle
|
||||||
|
input); your subroutine needs to identify the first position where the
|
||||||
|
four most recently received characters were all different. Specifically,
|
||||||
|
it needs to report the number of characters from the beginning of the
|
||||||
|
buffer to the end of the first such four-character marker.
|
||||||
|
|
||||||
|
For example, suppose you receive the following datastream buffer:
|
||||||
|
|
||||||
|
mjqjpqmgbljsphdztnvjfqwrcgsmlb
|
||||||
|
|
||||||
|
After the first three characters (mjq) have been received, there haven't
|
||||||
|
been enough characters received yet to find the marker. The first time a
|
||||||
|
marker could occur is after the fourth character is received, making the
|
||||||
|
most recent four characters mjqj. Because j is repeated, this isn't a
|
||||||
|
marker.
|
||||||
|
|
||||||
|
The first time a marker appears is after the seventh character arrives.
|
||||||
|
Once it does, the last four characters received are jpqm, which are all
|
||||||
|
different. In this case, your subroutine should report the value 7,
|
||||||
|
because the first start-of-packet marker is complete after 7 characters
|
||||||
|
have been processed.
|
||||||
|
|
||||||
|
Here are a few more examples:
|
||||||
|
|
||||||
|
• bvwbjplbgvbhsrlpgdmjqwftvncz: first marker after character 5
|
||||||
|
• nppdvjthqldpwncqszvftbrmjlhg: first marker after character 6
|
||||||
|
• nznrnfrfntjfmvfwmzdfjlvtqnbhcprsg: first marker after character 10
|
||||||
|
• zcfzfwzzqfrljwzlrfnpqdbhtmscgvjw: first marker after character 11
|
||||||
|
|
||||||
|
How many characters need to be processed before the first start-of-packet
|
||||||
|
marker is detected?
|
||||||
|
|
||||||
|
Your puzzle answer was 1544.
|
||||||
|
|
||||||
|
--- Part Two ---
|
||||||
|
|
||||||
|
Your device's communication system is correctly detecting packets, but
|
||||||
|
still isn't working. It looks like it also needs to look for messages.
|
||||||
|
|
||||||
|
A start-of-message marker is just like a start-of-packet marker, except it
|
||||||
|
consists of 14 distinct characters rather than 4.
|
||||||
|
|
||||||
|
Here are the first positions of start-of-message markers for all of the
|
||||||
|
above examples:
|
||||||
|
|
||||||
|
• mjqjpqmgbljsphdztnvjfqwrcgsmlb: first marker after character 19
|
||||||
|
• bvwbjplbgvbhsrlpgdmjqwftvncz: first marker after character 23
|
||||||
|
• nppdvjthqldpwncqszvftbrmjlhg: first marker after character 23
|
||||||
|
• nznrnfrfntjfmvfwmzdfjlvtqnbhcprsg: first marker after character 29
|
||||||
|
• zcfzfwzzqfrljwzlrfnpqdbhtmscgvjw: first marker after character 26
|
||||||
|
|
||||||
|
How many characters need to be processed before the first start-of-message
|
||||||
|
marker is detected?
|
||||||
|
|
||||||
|
Your puzzle answer was 2145.
|
||||||
|
|
||||||
|
Both parts of this puzzle are complete! They provide two gold stars: **
|
||||||
|
|
||||||
|
References
|
||||||
|
|
||||||
|
Visible links
|
||||||
|
. https://adventofcode.com/
|
||||||
|
. https://adventofcode.com/2022/about
|
||||||
|
. https://adventofcode.com/2022/events
|
||||||
|
. https://adventofcode.com/2022/settings
|
||||||
|
. https://adventofcode.com/2022/auth/logout
|
||||||
|
. Advent of Code Supporter
|
||||||
|
https://adventofcode.com/2022/support
|
||||||
|
. https://adventofcode.com/2022
|
||||||
|
. https://adventofcode.com/2022
|
||||||
|
. https://adventofcode.com/2022/support
|
||||||
|
. https://adventofcode.com/2022/sponsors
|
||||||
|
. https://adventofcode.com/2022/leaderboard
|
||||||
|
. https://adventofcode.com/2022/stats
|
||||||
|
. https://adventofcode.com/2022/sponsors
|
||||||
|
. https://adventofcode.com/2016/day/6
|
||||||
|
. https://adventofcode.com/2016/day/25
|
||||||
|
. https://adventofcode.com/2019/day/7
|
||||||
|
. https://adventofcode.com/2019/day/9
|
||||||
|
. https://adventofcode.com/2019/day/16
|
||||||
|
. https://adventofcode.com/2021/day/25
|
||||||
|
. https://adventofcode.com/2022
|
||||||
|
. https://adventofcode.com/2022/day/6/input
|
|
@ -0,0 +1 @@
|
||||||
|
mjqjpqmgbljsphdztnvjfqwrcgsmlb
|
Loading…
Reference in New Issue